DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and acbd4

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_998260.1 Gene:acbd4 / 406368 ZFINID:ZDB-GENE-040426-2074 Length:403 Species:Danio rerio


Alignment Length:88 Identity:37/88 - (42%)
Similarity:48/88 - (54%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQEFN---QAAEDV-----KNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKW 57
            |||:::..   |||.||     ||....|....:|..|.|:|||..|.|...:|||.|..|:.||
Zfish     6 MSEIEDCQRRFQAAVDVIQSLPKNGTYKPSYEVMLRFYGLFKQAVCGPCTLSRPGFWDPVGRYKW 70

  Fly    58 EAWNNRKGMSNTDAQAAYITKVK 80
            |||:|...||...|.|||:.::|
Zfish    71 EAWSNLGEMSRETAMAAYVDEMK 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 34/84 (40%)
acbd4NP_998260.1 ACBP 13..96 CDD:279259 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.