DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Acbp4

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_648081.1 Gene:Acbp4 / 38781 FlyBaseID:FBgn0035742 Length:84 Species:Drosophila melanogaster


Alignment Length:70 Identity:39/70 - (55%)
Similarity:48/70 - (68%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDA 71
            |.:|||..||.:..|.|::.||.|.|:|||||||.|.||||.||.|.||.:||||..||:|...|
  Fly     4 FEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKKKAMYEAWNAHKGLSKDAA 68

  Fly    72 QAAYI 76
            :.||:
  Fly    69 KEAYV 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 39/70 (56%)
Acbp4NP_648081.1 ACBP 4..81 CDD:395715 39/70 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2339
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D131319at33392
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - otm3578
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - P PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.