DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Eci2

DIOPT Version :10

Sequence 1:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus


Alignment Length:78 Identity:35/78 - (44%)
Similarity:43/78 - (55%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNT 69
            |:|..|...||.|...||:...|.||:||||||.|.|...|||..||..||||:|||....:...
  Rat    39 QDFENAMNQVKLLKKDPGNEVKLRLYALYKQATEGPCTMPKPGVFDFVNKAKWDAWNALGSLPKE 103

  Fly    70 DAQAAYITKVKAL 82
            .|:..|:..|.:|
  Rat   104 TARQNYVDLVSSL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 35/78 (45%)
Eci2NP_001006967.1 ACBP 38..113 CDD:459982 33/73 (45%)
crotonase-like 134..389 CDD:474030
ECH-like 149..319
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.