DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Dbi

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_114054.1 Gene:Dbi / 25045 RGDID:2490 Length:87 Species:Rattus norvegicus


Alignment Length:83 Identity:44/83 - (53%)
Similarity:59/83 - (71%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            :|::|||:||.|.|.|.|.::|.:||.:|||||||.|||:||.||.||||||::||..||.|..:
  Rat     5 DFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKEN 69

  Fly    71 AQAAYITKVKALIAAVGL 88
            |...|:.||:.|....|:
  Rat    70 AMKTYVEKVEELKKKYGI 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 43/80 (54%)
DbiNP_114054.1 ACBP 2..86 CDD:238248 43/80 (54%)
Acyl-CoA binding. /evidence=ECO:0000250 29..33 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7070
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4896
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - mtm8941
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - LDO PTHR23310
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.