powered by:
Protein Alignment Acbp1 and acbp-5
DIOPT Version :9
Sequence 1: | NP_001285744.1 |
Gene: | Acbp1 / 34111 |
FlyBaseID: | FBgn0031992 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499817.2 |
Gene: | acbp-5 / 176800 |
WormBaseID: | WBGene00011731 |
Length: | 274 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 33/71 - (46%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDK-PGFLDFKGKAKWEAWNNRKGMSNT 69
:|:.|...:....|......:|:.|.|||||..|..::.| |.:.:...:.|:.:|.....||.:
Worm 31 KFDAATTRLPGFLTKIDQKTILKFYGLYKQAVEGPADSKKGPYWFETVARKKFNSWLANSQMSRS 95
Fly 70 DAQAAY 75
.|..||
Worm 96 RAMEAY 101
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.