DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and maa-1

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_499531.1 Gene:maa-1 / 176612 WormBaseID:WBGene00007680 Length:266 Species:Caenorhabditis elegans


Alignment Length:87 Identity:32/87 - (36%)
Similarity:44/87 - (50%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FNQAAEDVKNLNTTPGD-------NDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRK 64
            |..|...|:||   |.|       ::.|..|:|:||||.|.|:..||.|.|.:|..||.|||...
 Worm     4 FETAVFIVQNL---PKDGPIKTSTDEKLNFYALFKQATHGKCDLPKPSFYDIQGVYKWNAWNKLD 65

  Fly    65 GMSNTDAQAAYITKVKALIAAV 86
            .|:..:|:.||:..:...|..|
 Worm    66 NMTMDEAKQAYVDSIVQKIREV 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 32/87 (37%)
maa-1NP_499531.1 ACBP 3..84 CDD:376410 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.