DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and gloB

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_414748.1 Gene:gloB / 944902 ECOCYCID:G6099 Length:251 Species:Escherichia coli


Alignment Length:249 Identity:67/249 - (26%)
Similarity:101/249 - (40%) Gaps:71/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RRILIDTGDEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFG 104
            |.:::|.||.: |...|...:..|.|     .|.|||.|||||||||.:|     ||..::..:|
E. coli    23 RCLIVDPGDAE-PVLNAIAANNWQPE-----AIFLTHHHHDHVGGVKELV-----EKFPQIVVYG 76

  Fly   105 RTDAPD-----VCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLAMNE-----GTL 159
            ..:..|     |..:..|...|     ..||:       |:.|||||..|:......     .||
E. coli    77 PQETQDKGTTQVVKDGETAFVL-----GHEFS-------VIATPGHTLGHICYFSKPYLFCGDTL 129

  Fly   160 FSGDC-ILGEGTAVFEDLFEYMKSLEKILDIKPQRIFPGHG----------NVIEEPIGKIEYY- 212
            |||.| .|.||||  ..:::.:|.|..:.|  ...:...|.          :::...:...:|| 
E. coli   130 FSGGCGRLFEGTA--SQMYQSLKKLSALPD--DTLVCCAHEYTLSNMKFALSILPHDLSINDYYR 190

  Fly   213 ----INHRNQ--------REQQILQFFVQRPNENLQAMDVVKVVYKET----PE 250
                :..:||        .|:||..|.      ..:.:|::.|:.:||    ||
E. coli   191 KVKELRAKNQITLPVILKNERQINVFL------RTEDIDLINVINEETLLQQPE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 53/182 (29%)
GloB 25..240 CDD:223565 61/233 (26%)
gloBNP_414748.1 PRK10241 1..251 CDD:182327 67/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.