DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and GLO4

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_014683.1 Gene:GLO4 / 854205 SGDID:S000005566 Length:285 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:63/206 - (30%)
Similarity:94/206 - (45%) Gaps:57/206 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GTN-TYLLGSGSRR--ILIDTGD--EDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGG---V 85
            |.| :|||.:..||  .|||..:  |..|:..|       :||.|||.|:.||.|:||.||   :
Yeast    24 GVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSA-------EEKKSIDAIVNTHHHYDHSGGNLAL 81

  Fly    86 KSIVGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRV--VHTPGHTTD 148
            .||:..:.:..|.::.. |...:|.| .|:|.:::.:.|          .|:||  :.||.||.|
Yeast    82 YSILCQENSGHDIKIIG-GSKSSPGV-TEVPDNLQQYHL----------GNLRVTCIRTPCHTKD 134

  Fly   149 HVV-----LAMNEGTLFSGDC--ILG-----EGTAVFEDLFEYMKSLEKIL-------DIKPQRI 194
            .:.     |...|..:|:||.  |.|     |||....|:     :|.:|:       :....:|
Yeast   135 SICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDM-----ALNQIMLRAVGETNWNKVKI 194

  Fly   195 FPGH----GNV 201
            :|||    |||
Yeast   195 YPGHEYTKGNV 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 63/206 (31%)
GloB 25..240 CDD:223565 63/206 (31%)
GLO4NP_014683.1 hydroxyacylglutathione_hydrolase_MBL-fold 18..198 CDD:293809 58/197 (29%)
HAGH_C 199..283 CDD:406513 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.