DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and GLO2

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_010558.3 Gene:GLO2 / 851865 SGDID:S000002680 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:53/191 - (27%)
Similarity:82/191 - (42%) Gaps:37/191 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GTN-TYLLGSGSRR--ILIDTGDEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSIVG 90
            |.| .|||.....:  .|||..:   |..:  |.::.:.||.|::.|:.||.|:||..|...|: 
Yeast    14 GVNYCYLLSDSKNKKSWLIDPAE---PPEV--LPELTEDEKISVEAIVNTHHHYDHADGNADIL- 72

  Fly    91 TKLAEKD--CRVFKFGRT-DAPDVCPEIPTDI-KLHPLAHNQEFTTEGANVRVVHTPGHTTDHVV 151
            ..|.||:  .:|...|.: |.|.| ..||.:: |||         .....:..:.||.||.|.:.
Yeast    73 KYLKEKNPTSKVEVIGGSKDCPKV-TIIPENLKKLH---------LGDLEITCIRTPCHTRDSIC 127

  Fly   152 LAMNEGT-----LFSGDCILG-------EGTAVFEDLFEYMKSLEKI--LDIKPQRIFPGH 198
            ..:.:.|     :|:||.:..       |||....|:......||.:  .:....|::|||
Yeast   128 YYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWSKTRVYPGH 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 53/191 (28%)
GloB 25..240 CDD:223565 53/191 (28%)
GLO2NP_010558.3 hydroxyacylglutathione_hydrolase_MBL-fold 16..188 CDD:293809 50/187 (27%)
HAGH_C 189..273 CDD:406513 53/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.