DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and GLY3

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_564636.2 Gene:GLY3 / 841793 AraportID:AT1G53580 Length:294 Species:Arabidopsis thaliana


Alignment Length:247 Identity:63/247 - (25%)
Similarity:100/247 - (40%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNTYLLGSGSR----RILIDTGDEDVPQYIAHLGDVLQQEKASIDTI--LLTHWHHDHVGGVKSI 88
            |.||||...|.    .:|||..|:.|.:      |:...::..:..|  :.||.|.|||.|. .:
plant    64 TFTYLLADVSHPDKPALLIDPVDKTVDR------DLKLIDELGLKLIYAMNTHVHADHVTGT-GL 121

  Fly    89 VGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLA 153
            :.|||......:.|...:.|         |:.|.|   ..:.:.....:.|..|||||...|...
plant   122 LKTKLPGVKSVISKASGSKA---------DLFLEP---GDKVSIGDIYLEVRATPGHTAGCVTYV 174

  Fly   154 MNEGT-------LFSGDCIL--GEGTAVFED-----LFEYMKSLEKILDI-KPQRIFPGH---GN 200
            ..||.       .|:||.:|  |.|...|::     |:|.:.|  :|..: |...|:|.|   |.
plant   175 TGEGADQPQPRMAFTGDAVLIRGCGRTDFQEGSSDQLYESVHS--QIFTLPKDTLIYPAHDYKGF 237

  Fly   201 VIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKETPENL 252
            .: ..:|: |...|.|..::::..:..:.  |.||....::.|.   .|.|:
plant   238 EV-STVGE-EMQHNPRLTKDKETFKTIMS--NLNLSYPKMIDVA---VPANM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 53/195 (27%)
GloB 25..240 CDD:223565 60/233 (26%)
GLY3NP_564636.2 PLN02962 51..292 CDD:178547 63/247 (26%)
POD-like_MBL-fold 53..234 CDD:293810 52/190 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.