DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and AT1G25375

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_564232.1 Gene:AT1G25375 / 839123 AraportID:AT1G25375 Length:524 Species:Arabidopsis thaliana


Alignment Length:261 Identity:67/261 - (25%)
Similarity:110/261 - (42%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GDEDVPQYIAHLGDVL-----------QQEKASIDT------ILLTHWHHDHVGGVKSIVGTKLA 94
            ||.....::|| ||.|           .:.|..:|.      :.:||.|.||:.|:.:|   :.:
plant   222 GDHQGADFVAH-GDALIVDPGCLSKLHVELKKIVDALPRKLIVFVTHHHRDHIDGLSAI---QES 282

  Fly    95 EKDCRVFKFGRTDAPDVCPEIPTDIKLH----------PLAHNQEFTTEGANVRVVHTPGHTTDH 149
            ..|..:....:|              .|          |::..:.....|..:.|:..||||..|
plant   283 NPDAILVAHAKT--------------RHRIGGWSGNYTPVSGGENIYVNGQKLTVIFAPGHTDGH 333

  Fly   150 V-VLAMNEGTLFSGDCILGEGTAVFE-----DLFEYMKSLEKILDIKPQRIFPGHGNVIEEPIGK 208
            : :|..:..:|..||..:|:|:|..:     ::.:|.:|..|.|::.|..:.|.||.|...|...
plant   334 MSLLHTSTQSLIVGDHCVGQGSAFLDIRAGGNMTDYFQSTYKFLELSPNVVIPMHGRVNLWPKHM 398

  Fly   209 IEYYINHRNQREQQILQFFVQRPNENLQAM-DVVKVVYKETPENLWPAAAYNVNHHLSKLEKEGK 272
            :..|:.:|..||:.||:..|    :..|.: |:|..||.......|.||:.||..|:.||..|.|
plant   399 LCGYLKNRRSREKSILKATV----DGAQTLYDIVAKVYSSVDRKFWWAASSNVRLHIEKLAVENK 459

  Fly   273 L 273
            |
plant   460 L 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 42/187 (22%)
GloB 25..240 CDD:223565 52/226 (23%)
AT1G25375NP_564232.1 metallo-hydrolase-like_MBL-fold 231..385 CDD:419960 37/171 (22%)
BLACT_WH 423..>459 CDD:407650 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4750
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D576967at2759
OrthoFinder 1 1.000 - - FOG0005792
OrthoInspector 1 1.000 - - oto2992
orthoMCL 1 0.900 - - OOG6_101772
Panther 1 1.100 - - LDO PTHR23131
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.