DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Mblac2

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_082648.1 Gene:Mblac2 / 72852 MGIID:1920102 Length:279 Species:Mus musculus


Alignment Length:212 Identity:50/212 - (23%)
Similarity:85/212 - (40%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NTYLLGSGSRRILIDT--GDEDVPQYIAHLG---DVLQQEKASIDTIL--LTHWHHDHVGGVKSI 88
            |.:|:....:.::|||  |...:|:|:...|   |...:|.|....:|  .||.|.||.||:...
Mouse    31 NIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDCGSKEDAGRRPLLAVATHVHFDHSGGLYQF 95

  Fly    89 --VGTKLAEKDCRVFKFGRTD---------------APD---------VCPEIPTDIKLHPLAHN 127
              |....||.:.    ..|.|               ||.         |....||.|    |...
Mouse    96 DQVAVHRAEAEA----LARGDNFETVTWLSDSEVVRAPSPGWRARQFRVQAVQPTLI----LQDG 152

  Fly   128 QEFTTEGANVRVVHTPGHTTDHVVL-AMNEGTLFSGDCILGEGTAV----FEDLFEYMKSLEKIL 187
            .........:.|:|.|||:...:.| ..:...||||| ::.:|:.:    :..:.:|:.:.|:::
Mouse   153 DVINLGDRQLTVMHMPGHSRGSICLHDKDRKVLFSGD-VVYDGSLIDWLPYSRISDYVGTCERLI 216

  Fly   188 DIKP----QRIFPGHGN 200
            ::..    :::.|||.|
Mouse   217 ELVDRGLVEKVLPGHFN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 50/212 (24%)
GloB 25..240 CDD:223565 50/212 (24%)
Mblac2NP_082648.1 MBLAC2-like_MBL-fold 22..231 CDD:293798 47/208 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.