DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Haghl

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001365709.1 Gene:Haghl / 68977 MGIID:1919877 Length:310 Species:Mus musculus


Alignment Length:267 Identity:59/267 - (22%)
Similarity:92/267 - (34%) Gaps:85/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DVLQQEKASIDTILLTHWHHDHVGGVKSIV----GTKLAEKDCRVFKFGRTDAPDVCPEIPTDIK 120
            ::..:|..|:..:|.||.|.||..|...:.    |..:...|.|:....|.              
Mouse    38 EIAGREGVSLTMVLSTHHHWDHTRGNAELAHILPGLAVLGADERICALTRR-------------- 88

  Fly   121 LHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLAMNEG------TLFSGD---------------- 163
               |.|.:.......:||.:.|||||:.|:...:.|.      .||||.                
Mouse    89 ---LEHGEGLQFGAIHVRCLLTPGHTSGHMSYFLWEDDCPDSPALFSGTVQPGFIYLPNSTVPSL 150

  Fly   164 ------CILGEGTAV------FEDLFEYM-KSLEKILDIKP--QRIFPGHGNVIEEPIGKIEY-- 211
                  |.||:..:|      .||..:.| :||.|.|...|  .::|.||    |..:..:|:  
Mouse   151 PPSDPLCSLGDALSVAGCGWHLEDTAQQMYQSLAKTLGTLPPETKVFCGH----EHTLSNLEFAQ 211

  Fly   212 YINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKETPENLWPAAAYNVNHHLSKLEKEGKLRVS 276
            .:...|:..|..|.:..:|.:|::..:          |..|.....||           ..|||:
Mouse   212 KVEPCNEHVQAKLSWAQERDDEDIPTV----------PSTLGEELMYN-----------PFLRVT 255

  Fly   277 KSADEEF 283
            :.|...|
Mouse   256 EDAVRAF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 43/182 (24%)
GloB 25..240 CDD:223565 50/222 (23%)
HaghlNP_001365709.1 PLN02469 1..272 CDD:178088 59/267 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.