DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Pnkd

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_006496230.1 Gene:Pnkd / 56695 MGIID:1930773 Length:398 Species:Mus musculus


Alignment Length:220 Identity:63/220 - (28%)
Similarity:98/220 - (44%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LQQEKASIDTILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAH 126
            :::|:.::..||.||.|.||.||.:.:   ....:||||:...:...|.:         .|||.|
Mouse   171 IEKERVNLVAILCTHKHWDHSGGNRDL---SRRHRDCRVYGSPQDGIPYL---------THPLCH 223

  Fly   127 NQEFTTEGANVRVVHTPGHTTDHVVLAMN------EGTLFSGDCILGEGTA-VFEDLFEYM-KSL 183
            ....:.....:|.:.|||||..|:|..::      ...|||||.:...|.. .||...|.| .||
Mouse   224 QDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSL 288

  Fly   184 EKILDIKPQR-IFPGHGNVIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKE 247
            :.:||:.... ::||| ...||.:| ....:...|...::.:| :|||     |.|:     .|.
Mouse   289 DTVLDLGDDTLLWPGH-EYAEENLG-FAGVVEPENLARERKMQ-WVQR-----QRME-----RKS 340

  Fly   248 T-PENLWPAAAYN--VNHHLSKLEK 269
            | |..|....|||  :..|..:|::
Mouse   341 TCPSTLGEERAYNPFLRTHCLELQE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 44/148 (30%)
GloB 25..240 CDD:223565 54/186 (29%)
PnkdXP_006496230.1 GSH_gloB 134..393 CDD:274569 63/220 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.