DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and pnkd

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001243139.1 Gene:pnkd / 497562 ZFINID:ZDB-GENE-050208-278 Length:361 Species:Danio rerio


Alignment Length:268 Identity:64/268 - (23%)
Similarity:114/268 - (42%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TRLTSSVIRILGCNPSAMTLQGTNTYLLGSGSR-RILIDTGDEDVPQYIAHLGDVLQQEKASIDT 71
            :|...::|..:...|..:.|...:..::.:.|. .:::|..|   ||.:.   ..|:.|..::..
Zfish    84 SRAQPTIINGIKIIPVPILLDNYSYVVIDTASNTAVVVDPAD---PQPVQ---ACLEAEGVALQA 142

  Fly    72 ILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQ--EFTTEG 134
            :|.||.|.||.||.:::   |.....|||:    .:|.|..|.:     .|||....  :|.|: 
Zfish   143 VLCTHKHWDHSGGNRAL---KRRYSSCRVY----GNAMDNIPGL-----THPLLDKDTIDFGTQ- 194

  Fly   135 ANVRVVHTPGHTTDHVVLAMN------EGTLFSGDCILGEGTA-VFE-DLFEYMKSLEKILDIKP 191
            .:.|..:|||||..|::..::      ..:|||||.:...|.. :|| :....:.||:.:..:..
Zfish   195 LHFRAFYTPGHTVGHMIYLLDGRAIGGPSSLFSGDLVFLSGCGRMFEGNASTMLSSLDTVGSLND 259

  Fly   192 QR-IFPGH---------------GNVIEEPIGKIEYYINHRNQR----------EQQILQFFVQR 230
            .. ::|||               |||:.|.  |:::.:..|:||          |:|...|....
Zfish   260 DTLLWPGHEYAEDNLLFAADVEPGNVVREQ--KLQWVLQQRSQRLCTCPSTLLEEKQYNPFLRSH 322

  Fly   231 PNENLQAM 238
            ..:..||:
Zfish   323 SQDLHQAL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 52/215 (24%)
GloB 25..240 CDD:223565 61/251 (24%)
pnkdNP_001243139.1 GSH_gloB 96..358 CDD:274569 62/256 (24%)
hydroxyacylglutathione_hydrolase_MBL-fold 97..267 CDD:293809 47/188 (25%)
HAGH_C 268..356 CDD:292741 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.