DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and ethe1

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_998094.1 Gene:ethe1 / 405865 ZFINID:ZDB-GENE-040426-2503 Length:279 Species:Danio rerio


Alignment Length:180 Identity:51/180 - (28%)
Similarity:71/180 - (39%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNTYLLGSGSRR--ILID----TGDEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSI 88
            |.||||.....|  :|||    |.|.|:        .::||...::...|.||.|.||      |
Zfish    62 TYTYLLADPDTREAVLIDPVLETVDRDL--------QLIQQLGLNLTVALNTHCHADH------I 112

  Fly    89 VGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLA 153
            .||.|.:|.....|.|.:.......:|       .|:.....|.....:.|..|||||...|...
Zfish   113 TGTGLLKKKVFGLKSGISKHSGAAADI-------QLSDGDSITFGKHCLMVRETPGHTDGCVTYV 170

  Fly   154 MNEGTL-FSGDCIL--GEGTAVFEDLFEYMKSLEKILDIKPQRIF--PGH 198
            ..:..: |:||.:|  |.|...|:     ..|..::.:...|:||  |||
Zfish   171 TGDQRMAFTGDALLIRGCGRTDFQ-----QGSPHRLYESVHQKIFSLPGH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 51/180 (28%)
GloB 25..240 CDD:223565 51/180 (28%)
ethe1NP_998094.1 PLN02962 51..278 CDD:178547 51/180 (28%)
POD-like_MBL-fold 51..224 CDD:293810 51/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.