DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and lactb2

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_998049.1 Gene:lactb2 / 405820 ZFINID:ZDB-GENE-040426-2257 Length:289 Species:Danio rerio


Alignment Length:287 Identity:143/287 - (49%)
Similarity:193/287 - (67%) Gaps:12/287 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALIPAVTRLTSSVIRILGCNPSAMTLQGTNTYLLGSGSRRILIDTGDEDVPQYIAHLGDVLQQEK 66
            |:||.:.:|::.|:|:|||||..||||||||||:|:|.||:|||.|:..||:||..|.:.|:|..
Zfish     3 AVIPRIEQLSARVVRVLGCNPGPMTLQGTNTYLVGTGRRRVLIDAGERAVPEYIVSLREALKQHD 67

  Fly    67 ASIDTILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFGRTDAPDVCPE----IPTDIKLHPLAHN 127
            .||..|::|||||||.|||:.|:.....:.:.||.|..|      ||.    |..|.|.:...::
Zfish    68 TSIQHIIVTHWHHDHTGGVQDILAHFNTDAELRVSKLPR------CPPQEEIIGDDKKKYSYLND 126

  Fly   128 QE-FTTEGANVRVVHTPGHTTDHVVLAM-NEGTLFSGDCILGEGTAVFEDLFEYMKSLEKILDIK 190
            .: ..||||.:||:.|||||.||:.|.: .|..:|||||||||||||||||.:|||||:|:|.||
Zfish   127 GDVIQTEGATLRVLFTPGHTDDHMALLLEEEQAVFSGDCILGEGTAVFEDLHDYMKSLQKLLSIK 191

  Fly   191 PQRIFPGHGNVIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKETPENLWPA 255
            ...|:||||.|:.:...||..||.|||.||||||...::.......:.::||||||||||:|..|
Zfish   192 ADLIYPGHGPVVHDAGSKIHEYIIHRNAREQQILNVLLENSGTAFTSSELVKVVYKETPEHLHRA 256

  Fly   256 AAYNVNHHLSKLEKEGKLRVSKSADEE 282
            |.:|:.|||.||.|:||:.:::.:||:
Zfish   257 AEFNLLHHLRKLLKDGKICLAEGSDEK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 101/194 (52%)
GloB 25..240 CDD:223565 108/220 (49%)
lactb2NP_998049.1 LACTB2-like_MBL-fold 14..203 CDD:293808 101/194 (52%)
GloB 23..217 CDD:223565 100/199 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9349
Inparanoid 1 1.050 277 1.000 Inparanoid score I2910
OMA 1 1.010 - - QHG61746
OrthoDB 1 1.010 - - D432155at33208
OrthoFinder 1 1.000 - - FOG0005792
OrthoInspector 1 1.000 - - oto39982
orthoMCL 1 0.900 - - OOG6_101772
Panther 1 1.100 - - LDO PTHR23131
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.