DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and CG30022

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725047.2 Gene:CG30022 / 36233 FlyBaseID:FBgn0050022 Length:279 Species:Drosophila melanogaster


Alignment Length:288 Identity:60/288 - (20%)
Similarity:98/288 - (34%) Gaps:104/288 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNTYLLG--SGSRRILIDTGDEDVPQYIAHLGDVLQQEKASIDTI----------LLTHWHHDHV 82
            |.:|||.  ...:.::||              .||:|.|.....:          :.||.|.||:
  Fly    60 TYSYLLADLKNGQAVIID--------------PVLEQAKRDAQLVKDLGFELKYAINTHMHADHI 110

  Fly    83 ---------GGVKSIVGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVR 138
                     .|.:|::......|..|....|  |..|....:                     :.
  Fly   111 TGSGWLRKLTGCQSVIAAASGAKADRHLNEG--DRIDFGTHV---------------------ID 152

  Fly   139 VVHTPGHTTDHVVLAM-NEGTLFSGDCIL--GEGTAVFED-----LFEYMKSLEKILDIKPQ--R 193
            .:.|||||...:...: ::|.:|:||.:|  |.|...|::     |:|.:.|  ||..: |:  |
  Fly   153 ALATPGHTNGCMTYVIKDQGCVFTGDTLLIRGCGRTDFQEGCPRNLYENVHS--KIFTL-PENFR 214

  Fly   194 IFPGHGNVIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKETPENLWPAAAY 258
            |:|.|               :::.|.|..:.:.....|.......:.||::     |||      
  Fly   215 IYPAH---------------DYKGQMESSVWEEKRYNPRLTKDIEEFVKIM-----ENL------ 253

  Fly   259 NVNHHLSKLEKEGKLRVSKSADEEFYVY 286
                   .|....|:..|..|:.|..||
  Fly   254 -------NLPYPKKIDASLPANRECGVY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 45/202 (22%)
GloB 25..240 CDD:223565 48/240 (20%)
CG30022NP_725047.2 PLN02962 45..277 CDD:178547 60/288 (21%)
POD-like_MBL-fold 49..221 CDD:293810 45/215 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.