DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and hagh

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_005163922.1 Gene:hagh / 336977 ZFINID:ZDB-GENE-030131-8921 Length:303 Species:Danio rerio


Alignment Length:304 Identity:71/304 - (23%)
Similarity:112/304 - (36%) Gaps:94/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVTRLTSSVIRILGCNPSAMTLQG----------TNTYLLGSGSRRILIDTGDEDV-------PQ 53
            |.|.|..|.||     .|::..|.          |:.|:.      :|||...::.       ||
Zfish    24 APTALFHSAIR-----KSSLVEQSDMKVELLPALTDNYMY------LLIDEETKEAAIVDPVEPQ 77

  Fly    54 YIAHLGDVLQQEKASIDTILLTHWHHDHVGG----VKSIVGTKLAEKDCRVFKFGRTDAPDVCPE 114
            .:.   |.:::....:.|:|.||.|.||.||    ||.:.|..:...|.||              
Zfish    78 KVV---DAVKKHGVKLKTVLTTHHHWDHAGGNEKLVKLMPGLTVYGGDDRV-------------- 125

  Fly   115 IPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLAMNE------GTLFSGDCILGEGTAVF 173
               ......:.|...|.....||:.:.||.||:.|:...:.:      ..:|:||.:...|...|
Zfish   126 ---GALTQKVTHYNTFKVGSLNVKCLFTPCHTSGHICYFVTKENSTEAPAVFTGDTLFVAGCGKF 187

  Fly   174 ED--LFEYMKSLEKILDIKP--QRIFPGHGNVIEEPIGKIEYYINHRNQREQQILQF--FVQRPN 232
            .:  ..|..|:|.::|...|  .|::.||           ||.||:        |:|  .|:..|
Zfish   188 FEGTADEMYKALIEVLGRLPPETRVYCGH-----------EYTINN--------LKFARHVEPNN 233

  Fly   233 ENLQAMDVVKVVY-KETPENLWP------AAAYNVNHHLSKLEK 269
            |.::    .|:.: ||..:|..|      |..:..|..:...||
Zfish   234 EVIR----TKLAWAKEKYDNGEPTIPSTVAEEFTFNPFMRVREK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 50/219 (23%)
GloB 25..240 CDD:223565 55/247 (22%)
haghXP_005163922.1 PLN02469 44..299 CDD:178088 63/279 (23%)
hydroxyacylglutathione_hydrolase_MBL-fold 49..216 CDD:293809 43/192 (22%)
HAGH_C 217..296 CDD:292741 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.