DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Haghl

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_006246126.1 Gene:Haghl / 302995 RGDID:1308042 Length:310 Species:Rattus norvegicus


Alignment Length:255 Identity:60/255 - (23%)
Similarity:93/255 - (36%) Gaps:77/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSIV----GTKLAEKDCRVFKFGRTDA 108
            |..||:   .|.::..:|..|:.|:|.||.|.||..|...:.    |..:...|.|:....|.  
  Rat    29 DVAVPK---RLLEIAGREGVSLTTVLSTHHHWDHTRGNAELARLQPGLAIMGADERICALTRR-- 88

  Fly   109 PDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLAMNEG------TLFSGD---- 163
                           |.|.:|......:||.:.|||||:.|:...:.|.      .||||.    
  Rat    89 ---------------LEHGEELQFGAIHVRCLLTPGHTSGHMSYFLWEDECPDPPALFSGTLQPG 138

  Fly   164 ------------------CILGEGTAV------FEDLFEYM-KSLEKIL-DIKPQ-RIFPGHGNV 201
                              |.||:..:|      .||..:.| :||.|.| .:.|| ::|.||   
  Rat   139 LTYQPNSTVSSRPPSDPLCSLGDALSVAGCGWHLEDTAQQMYQSLAKTLGTLPPQTKVFCGH--- 200

  Fly   202 IEEPIGKIEY--YINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKETPENLWPAAAYN 259
             |..:..:|:  .:...|...|..|.:..:|.::::..:          |..|.....||
  Rat   201 -EHTLSNLEFAQKVEPCNSHVQAKLSWAQKRDDDDVPTV----------PSTLGEELMYN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 50/194 (26%)
GloB 25..240 CDD:223565 56/234 (24%)
HaghlXP_006246126.1 PLN02469 1..272 CDD:178088 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.