DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and HAGH

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_005317.2 Gene:HAGH / 3029 HGNCID:4805 Length:308 Species:Homo sapiens


Alignment Length:283 Identity:62/283 - (21%)
Similarity:103/283 - (36%) Gaps:93/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNTYLLGSGSRRILIDTGDEDV-------PQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKS 87
            |:.|:.      ::||...::.       ||.:.   |..::....:.|:|.||.|.||.||.:.
Human    58 TDNYMY------LVIDDETKEAAIVDPVQPQKVV---DAARKHGVKLTTVLTTHHHWDHAGGNEK 113

  Fly    88 IV----GTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTD 148
            :|    |.|:...|.|:                 ....|.:.|.........||:.:.||.||:.
Human   114 LVKLESGLKVYGGDDRI-----------------GALTHKITHLSTLQVGSLNVKCLATPCHTSG 161

  Fly   149 HVVLAMNE------GTLFSGDCILGEGTAVFED--LFEYMKSLEKILDIKP--QRIFPGHGNVIE 203
            |:...:::      ..:|:||.:...|...|.:  ..|..|:|.::|...|  .|::.||     
Human   162 HICYFVSKPGGSEPPAVFTGDTLFVAGCGKFYEGTADEMCKALLEVLGRLPPDTRVYCGH----- 221

  Fly   204 EPIGKIEYYINHRNQREQQILQF--FVQRPNENLQAMDVVKVVYKETPENL-WPAAAYNVNHHLS 265
                  ||.||:        |:|  .|:..|..::             |.| |....|::     
Human   222 ------EYTINN--------LKFARHVEPGNAAIR-------------EKLAWAKEKYSI----- 254

  Fly   266 KLEKEGKLRVSKSADEEFYVYQP 288
                 |:..|..:..||| .|.|
Human   255 -----GEPTVPSTLAEEF-TYNP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 43/192 (22%)
GloB 25..240 CDD:223565 51/232 (22%)
HAGHNP_005317.2 PLN02469 49..304 CDD:178088 62/283 (22%)
hydroxyacylglutathione_hydrolase_MBL-fold 52..221 CDD:293809 41/188 (22%)
HAGH_C 222..302 CDD:292741 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.