DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Ethe1

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001099704.1 Gene:Ethe1 / 292710 RGDID:1311034 Length:254 Species:Rattus norvegicus


Alignment Length:322 Identity:75/322 - (23%)
Similarity:116/322 - (36%) Gaps:109/322 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTSSVIRILGCNPSAMTLQG--------------TNTYLLGSGSRR--ILID----TGDEDVPQY 54
            :.|:.:|:.|...|..:..|              |.|||||....|  ||||    |...|. |.
  Rat     1 MASTAVRVAGRRLSQQSASGAPVLLRQMFEPKSCTYTYLLGDRDSREAILIDPVLETAHRDA-QL 64

  Fly    55 IAHLGDVLQQEKASIDTILLTHWHHDHVGG---VKSI------VGTKL--AEKDCRVFKFGRTDA 108
            |..||       ..:...:.||.|.||:.|   ::|:      |.::|  |:.|..:   |..|:
  Rat    65 IKELG-------LKLLYAVNTHCHADHITGSGVLRSLLPGCQSVISRLSGAQADLHI---GEGDS 119

  Fly   109 PDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLAMNEGTL-FSGDCIL--GEGT 170
                  ||             |.......|.  :||||...|...:|:.:: |:||.:|  |.|.
  Rat   120 ------IP-------------FGRFALETRA--SPGHTPGCVTFVLNDQSMAFTGDALLIRGCGR 163

  Fly   171 AVFEDLFEYMKSL-----EKILDIKPQ-RIFPGHGNVIEEPIGKIEYY-INHRNQREQQILQFFV 228
            ..|:.  ...|:|     |||..:... .|:|.|           :|: :......|::.|    
  Rat   164 TDFQQ--GCAKTLYHSVHEKIFTLPGNCLIYPAH-----------DYHGLTVSTVEEERTL---- 211

  Fly   229 QRPNENLQAMDVVKVVYKETPENLWPAAAYNVNHHLSKLEKEGKLRVSKSADEEFYVYQPTS 290
             .|...|...:.:||:     :||             .|.|..::.::..|:....|..|.|
  Rat   212 -NPRLTLSCEEFIKVM-----DNL-------------NLPKPHQIDIAVPANMRCGVQTPPS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 59/228 (26%)
GloB 25..240 CDD:223565 61/255 (24%)
Ethe1NP_001099704.1 PLN02962 13..254 CDD:178547 71/308 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.