Sequence 1: | NP_609183.1 | Gene: | CG12375 / 34106 | FlyBaseID: | FBgn0031987 | Length: | 292 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056303.3 | Gene: | PNKD / 25953 | HGNCID: | 9153 | Length: | 385 | Species: | Homo sapiens |
Alignment Length: | 208 | Identity: | 57/208 - (27%) |
---|---|---|---|
Similarity: | 89/208 - (42%) | Gaps: | 35/208 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 LQQEKASIDTILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAH 126
Fly 127 NQEFTTEGANVRVVHTPGHTTDHVVLAMN------EGTLFSGDCILGEGTA-VFEDLFEYM-KSL 183
Fly 184 EKILDIKPQR-IFPGHGNVIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKE 247
Fly 248 T-PENLWPAAAYN 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12375 | NP_609183.1 | LACTB2-like_MBL-fold | 13..202 | CDD:293808 | 43/148 (29%) |
GloB | 25..240 | CDD:223565 | 51/186 (27%) | ||
PNKD | NP_056303.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 32..58 | ||
GSH_gloB | 121..380 | CDD:274569 | 57/208 (27%) | ||
Substrate binding. /evidence=ECO:0000250 | 291..293 | 1/2 (50%) | |||
Substrate binding. /evidence=ECO:0000250 | 376..379 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0491 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |