DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and PNKD

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_056303.3 Gene:PNKD / 25953 HGNCID:9153 Length:385 Species:Homo sapiens


Alignment Length:208 Identity:57/208 - (27%)
Similarity:89/208 - (42%) Gaps:35/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LQQEKASIDTILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAH 126
            :::|..::..||.||.|.||.||.:.:   ....:||||:...:...|.:         .|||.|
Human   158 IEKEGVTLVAILCTHKHWDHSGGNRDL---SRRHRDCRVYGSPQDGIPYL---------THPLCH 210

  Fly   127 NQEFTTEGANVRVVHTPGHTTDHVVLAMN------EGTLFSGDCILGEGTA-VFEDLFEYM-KSL 183
            ....:.....:|.:.|||||..|:|..::      ...|||||.:...|.. .||...|.| .||
Human   211 QDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSL 275

  Fly   184 EKILDIKPQR-IFPGHGNVIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKE 247
            :.:|.:.... ::||| ...||.:| ....:...|...::.:| :|||.          ::..|.
Human   276 DTVLGLGDDTLLWPGH-EYAEENLG-FAGVVEPENLARERKMQ-WVQRQ----------RLERKG 327

  Fly   248 T-PENLWPAAAYN 259
            | |..|....:||
Human   328 TCPSTLGEERSYN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 43/148 (29%)
GloB 25..240 CDD:223565 51/186 (27%)
PNKDNP_056303.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..58
GSH_gloB 121..380 CDD:274569 57/208 (27%)
Substrate binding. /evidence=ECO:0000250 291..293 1/2 (50%)
Substrate binding. /evidence=ECO:0000250 376..379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.