DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and SPCC13B11.03c

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_588246.1 Gene:SPCC13B11.03c / 2538985 PomBaseID:SPCC13B11.03c Length:256 Species:Schizosaccharomyces pombe


Alignment Length:266 Identity:66/266 - (24%)
Similarity:100/266 - (37%) Gaps:65/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSAMTLQGTNTYLLGSGSRR--ILIDTGDEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGG 84
            |..:..|....|||.....|  .::|..:.:|...|  |...|:.::..:..||.||.|.||.||
pombe     9 PMWVGTQDNYAYLLLCEETRQAAIVDPAEVNVVMPI--LKKKLKNKEIDLQAILTTHHHADHSGG 71

  Fly    85 VKSIVGTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDH 149
                 ...|.::...|..:|.:|...|.         |.|...:........:..:|||.||.|.
pombe    72 -----NLNLKKEFPHVTIYGGSDQNGVS---------HVLQDKETLRIGNVQIEALHTPCHTRDS 122

  Fly   150 VVL---AMNEGTLFSGDCILG-------EGTAVFEDLFEYMKSLEKILDIKPQR--IFPGH---- 198
            :..   :.||..:|:||.:..       ||||.     |...:|..:|...|..  |:|||    
pombe   123 ICFYAHSSNEHAVFTGDTLFNAGCGRFFEGTAA-----EMHIALNAVLSSLPNNTVIYPGHEYTK 182

  Fly   199 GNV-------IEEPIGKIEYYINHRNQ---------REQQILQFF-VQRP--------NENLQAM 238
            .||       ..|.:..:|...|| ||         :|:|...|. |..|        |:.::.|
pombe   183 SNVKFASKHLQSEALNHLEGLCNH-NQFIAGHITMGQEKQFNPFMRVTDPELQKHLGLNDPIKVM 246

  Fly   239 DVVKVV 244
            |.::.:
pombe   247 DELRTL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 52/204 (25%)
GloB 25..240 CDD:223565 64/257 (25%)
SPCC13B11.03cNP_588246.1 PLN02469 4..255 CDD:178088 66/266 (25%)
hydroxyacylglutathione_hydrolase_MBL-fold 7..178 CDD:293809 48/189 (25%)
HAGH_C 179..255 CDD:292741 16/75 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.