DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Hagh

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_203500.2 Gene:Hagh / 24439 RGDID:2779 Length:309 Species:Rattus norvegicus


Alignment Length:293 Identity:58/293 - (19%)
Similarity:108/293 - (36%) Gaps:82/293 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNTYLLGSGSRRILIDTGDEDV-------PQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKS 87
            |:.|:.      ::||...::.       ||.:.   :.:::.:..:.|:|.||.|.||.||.:.
  Rat    59 TDNYMY------LIIDEDTQEAAVVDPVQPQKVI---ETVKKHRVKLTTVLTTHHHWDHAGGNEK 114

  Fly    88 IV----GTKLAEKDCRVFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTD 148
            :|    |.|:...|.|:                 ....|.:.|.........:|:.:.||.||:.
  Rat   115 LVKLEPGLKVYGGDDRI-----------------GALTHKVTHLSTLQVGSLSVKCLSTPCHTSG 162

  Fly   149 HVVLAMNE------GTLFSGDCILGEGTAVFED--LFEYMKSLEKILDIKP--QRIFPGHGNVIE 203
            |:...:::      ..:|:||.:...|...|.:  ..|..|:|.::|...|  .:::.||     
  Rat   163 HICYFVSKPGSSEPSAVFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGH----- 222

  Fly   204 EPIGKIEYYINHRNQREQQILQF--FVQRPNENLQ-----AMDVVKVVYKETPENLWPAAAYN-- 259
                  ||.:|:        |:|  .|:..|..:|     |.:...:.....|..|.....||  
  Rat   223 ------EYTVNN--------LKFARHVEPGNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPF 273

  Fly   260 -------VNHHLSKLEKEGKLRVSKSADEEFYV 285
                   |..|..:.:....:|..:...::|.|
  Rat   274 MRVKEKTVQQHAGETDPVTTMRAIRREKDQFKV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 40/192 (21%)
GloB 25..240 CDD:223565 49/237 (21%)
HaghNP_203500.2 PLN02469 50..305 CDD:178088 56/290 (19%)
hydroxyacylglutathione_hydrolase_MBL-fold 55..222 CDD:293809 38/188 (20%)
HAGH_C 223..303 CDD:292741 16/87 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.