DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and C03A3.3

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_509880.2 Gene:C03A3.3 / 182131 WormBaseID:WBGene00007268 Length:287 Species:Caenorhabditis elegans


Alignment Length:281 Identity:61/281 - (21%)
Similarity:94/281 - (33%) Gaps:99/281 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LLGSGSRRILIDT--GDEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSIVGTKLAEK 96
            :||:....:||||  |..::..|:..|..:   |...| .:::||.|.:..||            
 Worm    30 ILGTEDTALLIDTGCGCGNIYHYLRSLSFM---ENMKI-IVVITHNHPEQTGG------------ 78

  Fly    97 DCRVFKFGRTD-------APDVCP-----------------EIPT-----------DIKLHPLAH 126
               .::|..|.       ..|:|.                 ||.|           .|.|...:|
 Worm    79 ---NWRFSTTGNNGLAHLVEDLCAGRKNKYYTRLMDSSWHWEIETYKVTRWLNDGDKIILGDESH 140

  Fly   127 NQEFTTEGANVRVVHTPGHTTDHVVL-AMNEGTLFSGDCILGEGTAVF----EDLFEYMKSLEKI 186
            ....      |:|:.|||||.|.:|| ......||.||........:|    .|:.:|..|:..|
 Worm   141 LMNI------VQVMWTPGHTPDSIVLWYPYANRLFVGDLFYRFDDIMFTYQYTDIRQYENSVRSI 199

  Fly   187 LD-IKPQRIFPGHGNVIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVVYKETPE 250
            |. :|.|.:             ::.|..: :|..:...|      |...|....::.|:      
 Worm   200 LKFVKSQDV-------------EVRYSAS-KNDTDNNCL------PTFKLYHRFLLAVI------ 238

  Fly   251 NLWPAAAYNVNHHLSKLEKEG 271
                 |..:|..||...|.||
 Worm   239 -----AGTHVGTHLRIDEAEG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 48/210 (23%)
GloB 25..240 CDD:223565 53/248 (21%)
C03A3.3NP_509880.2 metallo-hydrolase-like_MBL-fold 27..201 CDD:390040 45/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.