DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Y17G7B.3

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_496556.1 Gene:Y17G7B.3 / 174839 WormBaseID:WBGene00012459 Length:260 Species:Caenorhabditis elegans


Alignment Length:219 Identity:55/219 - (25%)
Similarity:92/219 - (42%) Gaps:64/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ILIDTGDEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFGRT 106
            :|:|..:|:..:.:|      .:|...|..:|.||.|:||.||.:..                |.
 Worm    28 LLVDLVNEEDYKELA------DKENIDITAVLTTHHHYDHCGGNEGF----------------RR 70

  Fly   107 DAPDV--------CPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVL--------AMN 155
            ..|:|        .|.:...:|...:|   ||.  |..::.:.||.||:.|:..        :.:
 Worm    71 QFPNVMILGGDSRIPAMDRHVKHGDMA---EFA--GLQIKCLSTPCHTSGHICYHITNPAADSTS 130

  Fly   156 EGTLFSGDC--ILG-----EGTAVFEDLFEYMKSLEKILDIKP--QRIFPGHGNVIEEPIGKIEY 211
            .|.:|:||.  |.|     ||||...|:     :|.:||...|  .:|||||    |..:..:::
 Worm   131 PGVVFTGDTLFIAGCGRFFEGTAPQMDV-----ALNEILKNLPVETQIFPGH----EYTVANLKF 186

  Fly   212 --YINHRNQREQQILQFFVQRPNE 233
              ::...|::..|.|: :.||..|
 Worm   187 ACHVEPGNEKAAQKLE-WAQRQIE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 48/184 (26%)
GloB 25..240 CDD:223565 55/219 (25%)
Y17G7B.3NP_496556.1 PLN02469 12..260 CDD:178088 55/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.