DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and MBLAC2

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_981951.2 Gene:MBLAC2 / 153364 HGNCID:33711 Length:279 Species:Homo sapiens


Alignment Length:209 Identity:47/209 - (22%)
Similarity:85/209 - (40%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NTYLLGSGSRRILIDT--GDEDVPQYIAHLGDVLQQEKASIDT------ILLTHWHHDHVGGVKS 87
            |.:|:....:.::|||  |...:|:|:...| :||..:|..|.      .:.||.|.||.||:..
Human    31 NIWLVRGSEQDVVIDTGLGLRSLPEYLYSSG-LLQDREAKEDAARRPLLAVATHVHFDHSGGLYQ 94

  Fly    88 IVGTKLAEKDCRVFKFG---------------RTDAPD-------VCPEIPTDIKLHPLAHNQEF 130
            .....:...:......|               ||.:|.       |....||.|    |......
Human    95 FDRVAVHHAEAEALARGDNFETVTWLSDSEVVRTPSPGWRARQFRVQAVQPTLI----LQDGDVI 155

  Fly   131 TTEGANVRVVHTPGHTTDHVVL-AMNEGTLFSGDCILGEGTAV----FEDLFEYMKSLEKILDIK 190
            ......:.|:|.|||:...:.| ..:...||||| ::.:|:.:    :..:.:|:.:.|:::::.
Human   156 NLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGD-VVYDGSLIDWLPYSRISDYVGTCERLIELV 219

  Fly   191 P----QRIFPGHGN 200
            .    :::.|||.|
Human   220 DRGLVEKVLPGHFN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 47/209 (22%)
GloB 25..240 CDD:223565 47/209 (22%)
MBLAC2NP_981951.2 MBLAC2-like_MBL-fold 22..231 CDD:293798 44/205 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.