DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and Hagh

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_077246.2 Gene:Hagh / 14651 MGIID:95745 Length:309 Species:Mus musculus


Alignment Length:277 Identity:59/277 - (21%)
Similarity:101/277 - (36%) Gaps:77/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DEDVPQYIAHLGDVLQQEK---------ASIDTILLTHWHHDHVGGVKSIV----GTKLAEKDCR 99
            |||..:  |.:.|.:|.:|         ..:.|:|.||.|.||.||.:.:|    |.|:...|.|
Mouse    68 DEDTQE--AAIVDPVQPQKVIEAAKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEPGLKVYGGDDR 130

  Fly   100 VFKFGRTDAPDVCPEIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLAMNE------GT 158
            :                 ....|.:.|.........:|:.:.||.||:.|:...:::      ..
Mouse   131 I-----------------GALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSA 178

  Fly   159 LFSGDCILGEGTAVFED--LFEYMKSLEKILDIKP--QRIFPGHGNVIEEPIGKIEYYINHRNQR 219
            :|:||.:...|...|.:  ..|..|:|.::|...|  .:::.||           ||.:|:    
Mouse   179 VFTGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGH-----------EYTVNN---- 228

  Fly   220 EQQILQF--FVQRPNENLQ-----AMDVVKVVYKETPENLWPAAAYN---------VNHHLSKLE 268
                |:|  .|:..|..:|     |.:...:.....|..|.....||         |..|..:.:
Mouse   229 ----LKFARHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETD 289

  Fly   269 KEGKLRVSKSADEEFYV 285
            ....:|..:...::|.|
Mouse   290 PVTTMRAIRREKDQFKV 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 41/176 (23%)
GloB 25..240 CDD:223565 50/221 (23%)
HaghNP_077246.2 PLN02469 50..305 CDD:178088 57/274 (21%)
hydroxyacylglutathione_hydrolase_MBL-fold 55..222 CDD:293809 39/172 (23%)
HAGH_C 223..303 CDD:292741 16/87 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.