DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and mblac2

DIOPT Version :10

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_002933979.1 Gene:mblac2 / 100490709 XenbaseID:XB-GENE-984229 Length:277 Species:Xenopus tropicalis


Alignment Length:212 Identity:52/212 - (24%)
Similarity:87/212 - (41%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NTYLLGSGSRRILIDT--GDEDVPQYIAHLGDVLQ-QEKASIDTILL---THWHHDHVGGVKSI- 88
            |.:|:....:.::|||  |...:|:|:...|.:.. |:..|....|:   ||.|.||.||:... 
 Frog    31 NIWLIRGSHQDLVIDTGLGLRSLPEYLCASGLLPHGQDGGSGRRPLMAVATHVHFDHAGGLHQFG 95

  Fly    89 ---VGTKLAE--------------KDCRVFKFGRTDAPD---------VCPEIPTDIKLHPLAHN 127
               |..:.||              .|..|.|     ||.         |....||    |.|...
 Frog    96 QVAVHRQEAEALTRGDNFETVTWLSDSEVVK-----APSPGWSASQYRVQSVKPT----HVLEDG 151

  Fly   128 QEFTTEGANVRVVHTPGHTTDHVVL-AMNEGTLFSGDCILGEGTAV----FEDLFEYMKSLEKIL 187
            ...:.....:.|:|.|||:...:.| ..:...||||| :..:|:.:    :.::.||::|.|::.
 Frog   152 DIISLGDRQLTVLHMPGHSRGSICLHDRDRKILFSGD-VAYDGSMIDWLPYSNIPEYVRSCERLK 215

  Fly   188 DIKP----QRIFPGHGN 200
            ::..    :::.|||.|
 Frog   216 ELVDRGLVEKVLPGHFN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 52/212 (25%)
BLACT_WH 237..274 CDD:407650
mblac2XP_002933979.1 MBLAC2-like_MBL-fold 22..230 CDD:293798 49/208 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.