DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12375 and mblac2

DIOPT Version :9

Sequence 1:NP_609183.1 Gene:CG12375 / 34106 FlyBaseID:FBgn0031987 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_002933979.1 Gene:mblac2 / 100490709 XenbaseID:XB-GENE-984229 Length:277 Species:Xenopus tropicalis


Alignment Length:212 Identity:52/212 - (24%)
Similarity:87/212 - (41%) Gaps:52/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NTYLLGSGSRRILIDT--GDEDVPQYIAHLGDVLQ-QEKASIDTILL---THWHHDHVGGVKSI- 88
            |.:|:....:.::|||  |...:|:|:...|.:.. |:..|....|:   ||.|.||.||:... 
 Frog    31 NIWLIRGSHQDLVIDTGLGLRSLPEYLCASGLLPHGQDGGSGRRPLMAVATHVHFDHAGGLHQFG 95

  Fly    89 ---VGTKLAE--------------KDCRVFKFGRTDAPD---------VCPEIPTDIKLHPLAHN 127
               |..:.||              .|..|.|     ||.         |....||    |.|...
 Frog    96 QVAVHRQEAEALTRGDNFETVTWLSDSEVVK-----APSPGWSASQYRVQSVKPT----HVLEDG 151

  Fly   128 QEFTTEGANVRVVHTPGHTTDHVVL-AMNEGTLFSGDCILGEGTAV----FEDLFEYMKSLEKIL 187
            ...:.....:.|:|.|||:...:.| ..:...||||| :..:|:.:    :.::.||::|.|::.
 Frog   152 DIISLGDRQLTVLHMPGHSRGSICLHDRDRKILFSGD-VAYDGSMIDWLPYSNIPEYVRSCERLK 215

  Fly   188 DIKP----QRIFPGHGN 200
            ::..    :::.|||.|
 Frog   216 ELVDRGLVEKVLPGHFN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12375NP_609183.1 LACTB2-like_MBL-fold 13..202 CDD:293808 52/212 (25%)
GloB 25..240 CDD:223565 52/212 (25%)
mblac2XP_002933979.1 MBLAC2-like_MBL-fold 22..230 CDD:293798 49/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.