DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt9

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001258844.1 Gene:B3gnt9 / 97440 MGIID:2142841 Length:399 Species:Mus musculus


Alignment Length:328 Identity:85/328 - (25%)
Similarity:134/328 - (40%) Gaps:58/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 AKKSVVLYSIDTEVPV------------------RMPLVKTIYKPGHLDSEIDMERICPQKGL-- 170
            |:.:.:.|..||.||.                  |.||:            |:..|.|...|.  
Mouse    63 ARAAPLAYEGDTPVPPTPTDPFDFGGYLRAKDQRRFPLL------------INQRRKCRSDGASG 115

  Fly   171 -STQLLVLITSSLRHSAARMSIRQTWMHYGSRRD--VGMAFVL---------GKGKNKSVKKAID 223
             |..||:.:.|.......|.::||||...|..:.  |...|:|         |.|.....:..::
Mouse   116 GSPDLLIAVKSVAADFERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRSHWRTLLE 180

  Fly   224 QEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTL-K 287
            .|...|.|::...|.|::.|||||.|..|.||...||...:|.|.|.|:|::|..||..:... .
Mouse   181 AESRAYADILLWAFEDTFFNLTLKEIHFLSWASAFCPDVHFVFKGDADVFVHVRNLLQFLELRDP 245

  Fly   288 ANRTIYGRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLK 352
            |...:.|......:|||.|.|||.|..|.||.|.:|.:..|..::|:|..:..|...........
Mouse   246 AQDLLAGDVIVQARPIRARASKYFIPRAVYGLPVYPAYAGGGGFVLSGATLRRLADACSQVELFP 310

  Fly   353 LEDVFTTGIVAESLNI--------RRVNVREMA---NTRTKFETCHIRDKITIHMVRNNEQFTLW 406
            ::||| .|:..:.|.:        |...:.:.:   :.|| |:.|..|:.:.:|.:...:.:.:|
Mouse   311 IDDVF-LGMCLQRLRLTPEPHPAFRTFGISQPSAAPHLRT-FDPCFYRELVVVHGLSAADIWLMW 373

  Fly   407 NML 409
            .:|
Mouse   374 RLL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 60/207 (29%)
B3gnt9NP_001258844.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..55
Galactosyl_T 132..331 CDD:389837 59/199 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.