DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3GALT1

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_066191.1 Gene:B3GALT1 / 8708 HGNCID:916 Length:326 Species:Homo sapiens


Alignment Length:243 Identity:78/243 - (32%)
Similarity:131/243 - (53%) Gaps:15/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSRRDVGMA--FVLGKGKNKSVKKAIDQEDFMYQDLIRGH 236
            |::||:::.:...||.:||:||....:.:.:.:|  |:|||..:..:.:.::||..::.|:|...
Human    80 LVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVED 144

  Fly   237 FIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLL--TLISTLKANRTIYGRRAEN 299
            |||||:||||||:..:.|....|.|||||:|||.|:|:|:..|:  .|..:.|..|..:.....|
Human   145 FIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVIN 209

  Fly   300 WKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAE 364
            ..|||:..||:::....|....:|.|.:|..|:.:.|:...:|..||:|..|.||||:.      
Human   210 GGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYV------ 268

  Fly   365 SLNIRRVNVREMANT-----RTKFETCHIRDKITIHMVRNNEQFTLWN 407
            .|.:|::.:....|:     :..:..|..|..||:|.:...|...:||
Human   269 GLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 66/191 (35%)
B3GALT1NP_066191.1 Galactosyl_T 92..279 CDD:250845 66/192 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5304
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4461
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm8535
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.