DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3GALT2

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_003774.1 Gene:B3GALT2 / 8707 HGNCID:917 Length:422 Species:Homo sapiens


Alignment Length:271 Identity:85/271 - (31%)
Similarity:130/271 - (47%) Gaps:23/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HLDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRR-----DVGMAFVLGKG 213
            |....|:....|.:|  |..|::||.:......||.:|||||   |:..     .:...|:||..
Human   135 HFKYIINEPEKCQEK--SPFLILLIAAEPGQIEARRAIRQTW---GNESLAPGIQITRIFLLGLS 194

  Fly   214 --KNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINV 276
              .|..:::||.:|...|.|:|:..::|:|.|||:||:..:.|...:||...||:|||.|||:|.
Human   195 IKLNGYLQRAILEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPHIPYVMKTDSDMFVNT 259

  Fly   277 PKLLTLISTLKAN---RTIY--GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGD 336
            ..|:..:  ||.:   |..|  |.....:.|.||:.||:::....|....:|.|.:|..|:.:||
Human   260 EYLINKL--LKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGD 322

  Fly   337 IVHALYVQSLNTAFLKLEDVFTTGIVAESLNIRRV---NVREMANTRTKFETCHIRDKITIHMVR 398
            :...::..||....|.||||: .||....|.|..|   |.....:.|..:.:|.....||.|..:
Human   323 LAEKIFKVSLGIRRLHLEDVY-VGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQ 386

  Fly   399 NNEQFTLWNML 409
            .:|....||.|
Human   387 PSELIKYWNHL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 68/202 (34%)
B3GALT2NP_003774.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
Galactosyl_T 165..359 CDD:250845 67/199 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5304
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4461
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm8535
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.