DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and AT1G77810

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001319398.1 Gene:AT1G77810 / 844443 AraportID:AT1G77810 Length:387 Species:Arabidopsis thaliana


Alignment Length:362 Identity:79/362 - (21%)
Similarity:152/362 - (41%) Gaps:61/362 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ADSIAAIRSRRIDEEKLH---DDGLDSKDILAKKSVVLYSIDTEVPVR-----MPLVKTIYKPGH 154
            :||.:.:.|:...:.:|.   ||...:|....:|.|....:.|...::     ...|.|:.....
plant    38 SDSGSQLISQHHRDHELQIVSDDCAHNKKATQEKDVTGEVLRTHEAIQDDRSLDKSVSTLSSTRS 102

  Fly   155 LDSEIDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSR-------RDVGMAFVLGK 212
            ....:|.....|:|  ...:::.|.::......|.|:|:|||..|.:       :.:.:.|::|.
plant   103 SQEMVDGSETNPRK--KVFMVMGINTAFSSRKRRDSVRETWMPQGEKLERLEQEKGIVIKFMIGH 165

  Fly   213 G--KNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKT-----ISLLEWADLHCPKAKYVLKTDD 270
            .  .|..:.:|||.||..::|.:|...::.|:.|:.||     .::.:|      .|::.:|.||
plant   166 SATSNSILDRAIDSEDAQHKDFLRLEHVEGYHELSAKTKIFFSTAVAKW------DAEFYIKVDD 224

  Fly   271 DMFINVPKLLTLISTLKANRTIYGRRAENWKPIRNRWSKYHISNA-QYGKPTFPYF--TTGPAYL 332
            |:.:|:..|.:.::..::...:|....::...:..:..|||.... ::|:....||  .||..|.
plant   225 DVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYA 289

  Fly   333 LTGDIVHALYVQSLNTAFLKL---EDV----FTTGIVAESLNIRRVNVREMANTRTKFETCHI-- 388
            ::.|:  |.|: |:|...|..   |||    :..|:..|.::.|........:.|.|.|...:  
plant   290 ISKDL--ANYI-SINQPILHKYANEDVSLGSWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCV 351

  Fly   389 ---------------RDKITIHMVRNNEQFTLWNMLL 410
                           |.|| :|.|.:..:..:||.||
plant   352 ASFEWSCSGICKSVERMKI-VHEVCSEGEGAVWNTLL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 51/211 (24%)
AT1G77810NP_001319398.1 PLN03193 6..384 CDD:178735 75/357 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.