DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and AT1G32930

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_174569.1 Gene:AT1G32930 / 840187 AraportID:AT1G32930 Length:399 Species:Arabidopsis thaliana


Alignment Length:406 Identity:83/406 - (20%)
Similarity:157/406 - (38%) Gaps:104/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AGRLLRCILILILVSFTVFTYVSK--VGVMEKVDYFTTAKPDVMSKNPAIQLVGEAIRLRSFREP 64
            :|...|.:.:|.:.||.:...|..  :...|.||....|.|:...::.::             .|
plant    12 SGVSARWVFVLCISSFLLGVLVVNRLLASFETVDGIERASPEQNDQSRSL-------------NP 63

  Fly    65 IKDFDDGFAVQISGNSSEGN--------KDIYTTIDGNINVAD-SIAAIRSRRIDEEKLHDDGLD 120
            :.|.:          |.||:        .|:..|:|..|:..: .:|..|:.|       .||.|
plant    64 LVDCE----------SKEGDILSRVSHTHDVIKTLDKTISSLEVELATARAAR-------SDGRD 111

  Fly   121 SKDILAKKSVVLYSIDTEVPVRMPLVKTIYKPGHLDSEIDMERICPQKGLSTQLLVLITSSLRHS 185
            ....:||                             :..|..:|.|:......::...:|..|  
plant   112 GSPAVAK-----------------------------TVADQSKIRPRMFFVMGIMTAFSSRKR-- 145

  Fly   186 AARMSIRQTWMHYG-------SRRDVGMAFVLGKGKNKS--VKKAIDQEDFMYQDLIRGHFIDSY 241
              |.|||.||:..|       :.:.:.|.||:|...:..  :...|:.|:..::|..|.:.|:.|
plant   146 --RDSIRGTWLPKGDELKRLETEKGIIMRFVIGHSSSPGGVLDHTIEAEEEQHKDFFRLNHIEGY 208

  Fly   242 NNLTLKT-----ISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTIYGRRAENWK 301
            :.|:.||     .::.:|      .|.:.:|.|||:.:|:..|.:.::..::...:|....::..
plant   209 HELSSKTQIYFSSAVAKW------DADFYIKVDDDVHVNLGMLGSTLARHRSKPRVYIGCMKSGP 267

  Fly   302 PIRNRWSKYHISNA-QYGKPTFPYF--TTGPAYLLTGDIVHALYVQSLNTAFLKL---EDVFTTG 360
            .:..:..|||.... ::|:....||  .||..|.::.|:  |.|: |:|...|..   ||| :.|
plant   268 VLAQKGVKYHEPEYWKFGEEGNKYFRHATGQIYAISKDL--ATYI-SVNRQLLHKYANEDV-SLG 328

  Fly   361 IVAESLNIRRVNVREM 376
            .....|::..::.|.:
plant   329 SWFIGLDVEHIDDRSL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 49/207 (24%)
AT1G32930NP_174569.1 PLN03193 7..399 CDD:178735 83/406 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.