DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and DD46

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_564154.1 Gene:DD46 / 838806 AraportID:AT1G22015 Length:398 Species:Arabidopsis thaliana


Alignment Length:288 Identity:71/288 - (24%)
Similarity:126/288 - (43%) Gaps:38/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EEKLHDDGLDSKDILAKKSVVLYSIDTEVPVRMPLVKTIYKPGHL--DSEIDMERICPQKGLSTQ 173
            |:|...|. |..:.:.|....:.|:|..|.:....:...:.|..:  .|..:......||. ...
plant    65 EKKKSQDN-DVMEEVLKTHKAIESLDKSVSMLQKQLSATHSPQQIVNVSATNSSTEGNQKN-KVF 127

  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSR-------RDVGMAFVLGKGK--NKSVKKAIDQEDFMY 229
            :::.|.::......|.|:|:|||..|.:       :.:.:.|::|...  |..:.|.||.||..|
plant   128 MVIGINTAFSSRKRRDSLRETWMPQGEKLEKLEKEKGIVVKFMIGHSSTPNSMLDKEIDSEDAQY 192

  Fly   230 QDLIRGHFIDSYNNLTLKTIS-----LLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKAN 289
            .|..|...::.|.||:.||.|     :.:|      .|::.:|.|||:.:|   |.||.|||.::
plant   193 NDFFRLDHVEGYYNLSAKTKSFFSSAVAKW------DAEFYVKIDDDVHVN---LGTLASTLASH 248

  Fly   290 RT---IYGRRAENWKPIRNRWSKYHISNA-QYGKPTFPYF--TTGPAYLLTGDIVHALYVQSLNT 348
            |:   :|....::...:..:.:||..... ::|:....||  .||..|.::.|:  |.|:.:...
plant   249 RSKPRVYIGCMKSGPVLTKKTAKYREPEFWKFGEEGNKYFRHATGQIYAISKDL--ATYISNNQP 311

  Fly   349 AFLKL--EDVFTTGIVAESLNIRRVNVR 374
            ...|.  ||| |.|.....|.:.:::.|
plant   312 ILHKYANEDV-TLGSWFIGLEVEQIDDR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 57/209 (27%)
DD46NP_564154.1 PLN03193 5..393 CDD:178735 71/288 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.