DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and AT4G32120

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_194939.1 Gene:AT4G32120 / 829344 AraportID:AT4G32120 Length:345 Species:Arabidopsis thaliana


Alignment Length:261 Identity:60/261 - (22%)
Similarity:108/261 - (41%) Gaps:67/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KSVVLYSIDTE---VPVRMPLVKTIYKPGHLDSEIDMERICPQKGLST---QLLVLI---TSSLR 183
            |.|||...|.|   |...|.|.:. ...|:|..         ||.:|:   ::|.:|   |....
plant    76 KLVVLGCKDLERRIVETEMELAQA-KSQGYLKK---------QKSVSSSGKKMLAVIGVYTGFGS 130

  Fly   184 HSAARMSIRQTWMHYG------SRRDVGMAFVLGKGKNK--SVKKAIDQEDFMYQD-LIRGHFID 239
            | ..|...|.:||...      ..|.|.:.||:|:..|:  |:.:.||:|:...:| ||..:..:
plant   131 H-LKRNKFRGSWMPRDDALKKLEERGVVIRFVIGRSANRGDSLDRKIDEENRATKDFLILENHEE 194

  Fly   240 SYNNLTLK-----TISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTL-----------ISTLKA 288
            :...|..|     :.::..|      .|::.:|.||::.:::..::.|           |..:|:
plant   195 AQEELPKKVKFFYSAAVQNW------DAEFYVKVDDNVDLDLEGMIALLESRRSQDGAYIGCMKS 253

  Fly   289 NRTIYGRRAENWKPIRNRWSKYHISNAQYGKPTFPYF--TTGPAYLLTGDIVHALYVQSLNTAFL 351
            ...|....::.::|   .|.|:....:        ||  .||...:|:.::  |.|| ::|:..|
plant   254 GDVITEEGSQWYEP---EWWKFGDDKS--------YFRHATGSLVILSKNL--AQYV-NINSGLL 304

  Fly   352 K 352
            |
plant   305 K 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 42/194 (22%)
AT4G32120NP_194939.1 DUF4094 24..102 CDD:290073 9/26 (35%)
Galactosyl_T 134..328 CDD:304462 42/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.