DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and AT2G32430

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_180802.1 Gene:AT2G32430 / 817804 AraportID:AT2G32430 Length:409 Species:Arabidopsis thaliana


Alignment Length:315 Identity:68/315 - (21%)
Similarity:134/315 - (42%) Gaps:58/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SRRIDEEKLHDDGLDSKDILAKK----------------------SVVLYSIDTEVPVRMPLVKT 148
            |...:..||..:|.|.|.:..|:                      ...:.|::.|:.......::
plant    54 STEAERLKLISEGCDPKTLYQKEVNRDPQALFGEVSKTHNAIQTLDKTISSLEMELAAARSAQES 118

  Fly   149 IYKPGHLDSEIDMERICPQKGLSTQLLVL-ITSSLRHSAARMSIRQTWMHYGSRR-------DVG 205
            :.....:.::::.:::   .|....|:|: |.::......|.|:|.|||..|.:|       .:.
plant   119 LVNGAPISNDMEKKQL---PGKRRYLMVVGINTAFSSRKRRDSVRTTWMPSGEKRKKLEEEKGII 180

  Fly   206 MAFVLGKGKNKS--VKKAIDQEDFMYQDLIRGHFIDSYNNLTLKT-----ISLLEWADLHCPKAK 263
            :.||:|......  :.::|:.||..:.|.:|...::.|..|:.||     .::.:|      .|:
plant   181 IRFVIGHSATAGGILDRSIEAEDKKHGDFLRLDHVEGYLELSGKTKTYFSTAVSKW------DAE 239

  Fly   264 YVLKTDDDMFINVPKL-LTLISTLKANRTIYGRRAENWKPIRNRWSKYHISNA-QYGKPTFPYF- 325
            :.:|.|||:.:|:..| .||:...|.:| :|....::...:..:..:||.... ::|:....|| 
plant   240 FYVKVDDDVHVNIATLGETLVRHRKKHR-VYLGCMKSGPVLSQKGVRYHEPEYWKFGENGNKYFR 303

  Fly   326 -TTGPAYLLTGDIVHALYVQSLNTAFLKL---EDVFTTGIVAESLNIRRVNVREM 376
             .||..|.::.|:  |.|: |||...|..   ||| |.|.....|::..::.|.:
plant   304 HATGQLYAISRDL--ASYI-SLNQHVLHKYANEDV-TLGAWFIGLDVTHIDDRRL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 54/208 (26%)
AT2G32430NP_180802.1 PLN03193 1..409 CDD:178735 68/315 (22%)
DUF4094 17..115 CDD:290073 9/60 (15%)
Galactosyl_T 154..352 CDD:304462 54/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.