DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt10.1

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001122271.1 Gene:b3galt10.1 / 798349 ZFINID:ZDB-GENE-080722-3 Length:379 Species:Danio rerio


Alignment Length:214 Identity:71/214 - (33%)
Similarity:115/214 - (53%) Gaps:25/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 IDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRDV-GMA----FVLGKGKNKSV 218
            :|...||.|:  :..|::::..:.....||.:||.||   |:...| |.|    |::|.......
Zfish   118 LDEPDICKQR--NPFLVLMVPVAPYEVKARNAIRSTW---GNETTVQGKAVLTLFLVGLTVGADS 177

  Fly   219 KKA---IDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLL 280
            :||   :::|...::|||:.:|:|||.|||:||:.:::|....||:|.|.:|.|.|||:||..|:
Zfish   178 EKAQQQLEEESRQHRDLIQSNFVDSYFNLTIKTMVIMDWLATRCPQAYYSMKIDSDMFLNVDNLV 242

  Fly   281 TLISTLKANRTIY--GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGD----IVH 339
            ||:|.....|..|  |....|...:||:.||:::|...|.:|.:|.:..|..|:.:.|    ||.
Zfish   243 TLLSAPNTPRENYITGVLMRNRFVVRNKNSKWYVSEELYPEPKYPTYLLGMGYVFSNDLPSKIVE 307

  Fly   340 AL-YVQSLNTAFLKLEDVF 357
            |. ||:..|     :||.:
Zfish   308 ASNYVKPFN-----IEDAY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 66/187 (35%)
b3galt10.1NP_001122271.1 Galactosyl_T 143..337 CDD:304462 66/187 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm8423
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.