DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt11

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001122268.1 Gene:b3galt11 / 798206 ZFINID:ZDB-GENE-030131-4878 Length:362 Species:Danio rerio


Alignment Length:260 Identity:65/260 - (25%)
Similarity:126/260 - (48%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 IDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSR----RDVGMAFVLG--KGKN-K 216
            |:...||.::  ...:::::........||..||.||.  |.:    ::|.:.|:||  .|.: :
Zfish    98 INQPGICEER--KPYVVIIVPVPPHDFNARNGIRNTWA--GEKVVEGKEVLVLFILGLHSGDDEE 158

  Fly   217 SVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLT 281
            ::::.:..|...|:||::.:|.|||.|||:||:.::||....|.:|.|.:|.|.|:.:||..|:.
Zfish   159 TLQEQLRNESQQYKDLLQSNFQDSYRNLTIKTMMMMEWLSRDCQQASYAVKVDADVLLNVNNLIN 223

  Fly   282 LISTLKANRTIY--GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQ 344
            ::.:|...::.|  |...:....||:..:|:.:....|.|..:|.:..|..|:::.|:......:
Zfish   224 MLVSLNTVQSNYMTGLVWDASPVIRDSSNKFFLPYDVYPKYAYPPYPLGMCYIISLDLPQKFLKE 288

  Fly   345 SLNTAFLKLEDVFTTGIVAESLNIRRV---NVREMANTRTKFETCHIRDKITIHMVRNNEQFTLW 406
            |.....|.:||.: .|:..|.|.|..|   |:.:......::..|:....|.:.....|:..:.|
Zfish   289 SKKIKPLYIEDAY-LGMCLEHLGIAPVKPPNMDQFVVKPPQYNRCYFSRLIAVLTDNTNQMTSFW 352

  Fly   407  406
            Zfish   353  352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 58/199 (29%)
b3galt11NP_001122268.1 Galactosyl_T 123..317 CDD:304462 57/196 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.