DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3gnt5b

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001093515.1 Gene:b3gnt5b / 791470 ZFINID:ZDB-GENE-041010-166 Length:401 Species:Danio rerio


Alignment Length:230 Identity:71/230 - (30%)
Similarity:121/230 - (52%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 IDMERICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRR--------DVGMAFVLG---- 211
            |:.:..|..|.:  .||:.:.||..:...|.:||.||   |:..        :|.:.|.||    
Zfish    94 INHQTTCDNKDI--LLLLFVKSSSENFERRQAIRSTW---GNETFIENTLGVNVKVLFALGLHPI 153

  Fly   212 ---KGKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMF 273
               :||   :|:.:..||..|.|||:..|:|:::|||||.:..|.|.:.:|..|::::..|||:|
Zfish   154 PEERGK---LKEDLMFEDQKYHDLIQQDFMDTFHNLTLKLLLQLGWKETYCHHAQFLMSADDDVF 215

  Fly   274 INVPKLLTLISTLKANRT---IYGRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTG 335
            ::.|.|:..:.....:.|   ..||......|.|::.|||::|...|...::|.:|.|..|:|:.
Zfish   216 VHTPNLILYLQGFGQSNTRDLWIGRVHRGSPPNRDKESKYYVSRDLYPWLSYPDYTPGSGYVLSR 280

  Fly   336 DIVHALYVQSL--NTAFLKLEDVFTTGIVAESLNI 368
            |:|..:|..||  |.:| .::||| .||.|:.:::
Zfish   281 DVVSRIYQASLTINASF-HIDDVF-LGICAKMMDV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 64/203 (32%)
b3gnt5bNP_001093515.1 Galactosyl_T 119..317 CDD:304462 64/203 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.