DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt3

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_082465.3 Gene:B3gnt3 / 72297 MGIID:2152535 Length:372 Species:Mus musculus


Alignment Length:263 Identity:70/263 - (26%)
Similarity:117/263 - (44%) Gaps:20/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSRRDVG----MAFVLGKGKN----KSVKKAIDQEDFMYQ 230
            ||:.|.||..:...|..:|.||..  .||..|    ..|::|..::    :...:.::.|...|.
Mouse   109 LLLAIKSSPANYGRRQMLRTTWAR--ERRVRGAPLRRLFLVGSDRDPQQARKYNRLLELEAQKYG 171

  Fly   231 DLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTIY-G 294
            |:::..|.||:.|||||.:..|||...:|..|.:||..|||:|.:...::|.:.....::.:: |
Mouse   172 DILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVTYLQDHDPDQHLFVG 236

  Fly   295 RRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTT 359
            ...:|..|||..||||.|......:..:|.:..|..:||:...|.||...:.......::||| .
Mouse   237 HLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVAALRRAARVLPMFPIDDVF-L 300

  Fly   360 GIVAES--------LNIRRVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNMLLDDTIKC 416
            |:..:.        ..:|...|...:...:.|:.|..||.:.:|.....|...:|:.|....:.|
Mouse   301 GMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALNQPQLLC 365

  Fly   417 DNQ 419
            ..|
Mouse   366 GRQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 54/204 (26%)
B3gnt3NP_082465.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..56
Galactosyl_T 122..311 CDD:389837 53/191 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8765
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.