DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galt6

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001016095.2 Gene:b3galt6 / 548849 XenbaseID:XB-GENE-974114 Length:343 Species:Xenopus tropicalis


Alignment Length:266 Identity:73/266 - (27%)
Similarity:116/266 - (43%) Gaps:48/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 QKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRR--DVGMAFVLG-KGKNKSVKKAIDQEDFM 228
            :|.:||.|:|||.|..::|..|..||.||:.....|  :|...||:| .|..:....|::.|...
 Frog    68 EKSVSTFLVVLIASGPKYSERRSIIRSTWLSGIPSRAGEVWGRFVIGTAGLGEEESAALEMEQRR 132

  Fly   229 YQD-LIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTI 292
            :.| |:.....|||.|||.|.:.:..|.|.|. ..|:|||.|||.|..:..|:..:...:.:|..
 Frog   133 HGDLLLLPDLQDSYENLTAKLLRMYVWLDRHI-DYKFVLKADDDTFARLDLLVDELRAKEPHRLY 196

  Fly   293 YG--------RRAENWKPIRNRW--SKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLN 347
            :|        :.|..||  .:.|  ..|::          || ..|..|:::.|:|..|   ||:
 Frog   197 WGFFSGRGRVKSAGKWK--ESSWVLCDYYL----------PY-ALGGGYVISWDLVRYL---SLS 245

  Fly   348 TAFL---KLEDVFTTGIVAESLNIRRVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNML 409
            ..||   :.||| :.|.....|.::|::.... :|..|...|            ||:........
 Frog   246 QDFLAHWQSEDV-SLGAWLAPLELKRLHDPRF-DTEYKSRGC------------NNKYLVTHKQS 296

  Fly   410 LDDTIK 415
            ::|.::
 Frog   297 IEDMLE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 58/204 (28%)
b3galt6NP_001016095.2 Galactosyl_T 87..274 CDD:328824 58/204 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.