DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3galnt2

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001011210.1 Gene:b3galnt2 / 496641 XenbaseID:XB-GENE-1012156 Length:488 Species:Xenopus tropicalis


Alignment Length:146 Identity:42/146 - (28%)
Similarity:72/146 - (49%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 AIDQEDFM-------YQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPK 278
            |:::||.:       :||::..|.:|:|.|:..|.::..:|. ......:::||||||.||::..
 Frog   290 ALEKEDALLQEESTTFQDIVFVHVVDTYRNVPSKLLNFYQWT-AEFTSFEFLLKTDDDCFIDIEN 353

  Fly   279 LLTLIS--TLKANRTIYGRRAENWKPIR-NRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHA 340
            :|..|:  .|:...|.:|....||...| .:|.:     .:|..|.:|.|..|..|:::.|||..
 Frog   354 VLEKIAHKQLQKENTWWGNFRLNWAVDRTGKWQE-----LEYLSPAYPAFACGSGYVISQDIVQW 413

  Fly   341 LYVQSLNTAFLKLEDV 356
            |...|......:.|||
 Frog   414 LASNSQRLKTYQGEDV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 42/146 (29%)
b3galnt2NP_001011210.1 Galactosyl_T 292..445 CDD:304462 41/144 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.