DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3gnt3.1

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_005166892.1 Gene:b3gnt3.1 / 494166 ZFINID:ZDB-GENE-040625-129 Length:424 Species:Danio rerio


Alignment Length:282 Identity:73/282 - (25%)
Similarity:133/282 - (47%) Gaps:29/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 IDMERIC--PQKGLSTQLLVLITSSLRHSAARMSIRQTW----MHYG--SRRDVGMAFVLGKGKN 215
            :|:...|  .|......||::|.||..:...|..:|:||    :|.|  .||    .|::|..::
Zfish   131 LDVHDKCGGAQNSADVFLLLVIKSSPENYDRREVLRKTWAEERLHKGVWIRR----VFIIGTSRS 191

  Fly   216 KSVKKAIDQ----EDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINV 276
            ...|..:::    |:...:|:::..|.||:.|||||.|..|:|.|..||.|:::|..|||:|.|.
Zfish   192 GFEKHRLNRLLKLENNENKDILQWDFNDSFFNLTLKQILFLQWMDRRCPNARFLLDGDDDIFANT 256

  Fly   277 PKLLTLISTLKAN---RTIY-GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDI 337
            ..::..:...:.|   |.:: |...:..||||...|||::....:....:|.:..|..:||:|..
Zfish   257 FNMIEYLQGQEDNDGSRHLFTGHLLQKVKPIRKLSSKYYVPVQIHESNRYPPYCGGGGFLLSGFT 321

  Fly   338 VHALYVQSLNTAFLKLEDVFTTGIVAES--------LNIRRVNVREMANTRTKFETCHIRDKITI 394
            ...:|..|.:...|.::||: .|:..|.        ..:|...:........|.:.|:.|:.:.:
Zfish   322 ARTIYKMSHSIILLPIDDVY-MGMCLEKAGLQPTFHFGVRTFGMNVPIKNADKLDPCYYREILVV 385

  Fly   395 HMVRNNEQFTLWNMLLDDTIKC 416
            |..:.:..|.:||.:.:..::|
Zfish   386 HRFQPHMIFVMWNEIQNPDLQC 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 57/209 (27%)
b3gnt3.1XP_005166892.1 Galactosyl_T 160..354 CDD:304462 56/198 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.