DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3gnt5

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_989240.1 Gene:b3gnt5 / 394849 XenbaseID:XB-GENE-955708 Length:377 Species:Xenopus tropicalis


Alignment Length:258 Identity:73/258 - (28%)
Similarity:132/258 - (51%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTW-------MHYGSRRDVGMAFVLG----KGKNKSVKKAIDQEDF 227
            ||:.:.:|..:...|.:||:||       ..|.:  ::.:.|.||    ..|:...:|.:..|:.
 Frog    89 LLLFVKTSPENRRRRNAIRKTWGNEDYIRSQYAA--NIKVVFALGIEADPVKSHQTQKDLVIENK 151

  Fly   228 MYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTI 292
            .:.|||:..|.|:::|||||.:....|.:.:||.||:::..|||:|::.|.|::.:.:|......
 Frog   152 RFNDLIQQDFKDTFHNLTLKLLLQFGWVNSYCPSAKFIMSADDDIFVHTPNLVSYLKSLPIETQD 216

  Fly   293 Y--GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALY--VQSLNTAFLKL 353
            :  ||......|||::.|||::....|...::|.:|.|.||:::.|:...:|  .|:|||: |.:
 Frog   217 FWIGRVHRGSPPIRSKTSKYYVPYEMYPWSSYPDYTAGAAYVVSKDVAAKVYEASQTLNTS-LYI 280

  Fly   354 EDVFTTGIVAESLN-IRRVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNMLLDDTIK 415
            :||| .||.|..:. :.:.:|......:..:..|.....||.|...::..: ||....|..:|
 Frog   281 DDVF-MGICANKMGVVPQYHVYFAGEGKAPYHPCIYNKMITSHGHLDDLDY-LWRQATDPNVK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 61/203 (30%)
b3gnt5NP_989240.1 Galactosyl_T 101..297 CDD:389837 61/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.