DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3galt1

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001102424.1 Gene:B3galt1 / 366064 RGDID:1311898 Length:326 Species:Rattus norvegicus


Alignment Length:243 Identity:78/243 - (32%)
Similarity:131/243 - (53%) Gaps:15/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHYGSRRDVGMA--FVLGKGKNKSVKKAIDQEDFMYQDLIRGH 236
            |::||:::.:...||.:||:||....:.:.:.:|  |:|||..:..:.:.::||..::.|:|...
  Rat    80 LVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVED 144

  Fly   237 FIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLL--TLISTLKANRTIYGRRAEN 299
            |||||:||||||:..:.|....|.|||||:|||.|:|:|:..|:  .|..:.|..|..:.....|
  Rat   145 FIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVIN 209

  Fly   300 WKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFTTGIVAE 364
            ..|||:..||:::....|....:|.|.:|..|:.:.|:...:|..||:|..|.||||:.      
  Rat   210 GGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYV------ 268

  Fly   365 SLNIRRVNVREMANT-----RTKFETCHIRDKITIHMVRNNEQFTLWN 407
            .|.:|::.:....|:     :..:..|..|..||:|.:...|...:||
  Rat   269 GLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 66/191 (35%)
B3galt1NP_001102424.1 Galactosyl_T 92..279 CDD:250845 66/192 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5327
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4385
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - mtm9010
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.