DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and b3gnt5a

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_942577.1 Gene:b3gnt5a / 336526 ZFINID:ZDB-GENE-030131-8470 Length:379 Species:Danio rerio


Alignment Length:303 Identity:83/303 - (27%)
Similarity:147/303 - (48%) Gaps:33/303 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LDSKDILAKKSVVLYSIDTEVPVRMPLVKTIYKPGHLDSEIDMERICPQKGLSTQLLVLITSSLR 183
            ::|.|.:.|.    .|:..|...|.         |.....:|...:|..|  ...||:.:.||..
Zfish    50 INSYDFINKS----LSVSPEEAARF---------GSFPYLLDRRDVCKNK--DVLLLLFVKSSPG 99

  Fly   184 HSAARMSIRQTWMH--YGSRR---DVGMAFVLG----KGKNKSVKKAIDQEDFMYQDLIRGHFID 239
            :...|.:||.||.:  |.|:.   .|.:.|.:|    :..:|::::.:.:|...:.|||:..|:|
Zfish   100 NFKRRQAIRSTWGNESYISQELGVVVKVVFAMGVRPDRSGHKTMQRELRKEHMAHHDLIQQDFLD 164

  Fly   240 SYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKAN--RTIY-GRRAENWK 301
            :::|||:|.:....|...:|..|.:::..|||:||:||.|:..:..||:.  |.:: |.......
Zfish   165 TFHNLTVKLLLQFRWTHENCAHAHFLMSADDDVFIHVPNLVHYLQELKSQNVRNLWVGHVHRGAP 229

  Fly   302 PIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALY--VQSLNTAFLKLEDVFTTGIVAE 364
            |:|.|.|||::....|...::|.:|.|..|:::||:...:|  .|||| |.:.::||| .||.|.
Zfish   230 PVRKRDSKYYMPFDMYQWSSYPDYTAGAGYVVSGDVAAKIYQATQSLN-ASMYIDDVF-MGICAI 292

  Fly   365 SLNIR-RVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLW 406
            :..:. :.:|......:|.:..|.....||.|....:.:: ||
Zfish   293 AAGVSPQEHVYFSGEGKTPYHPCIYEKMITSHGHEGDIRY-LW 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 61/202 (30%)
b3gnt5aNP_942577.1 Galactosyl_T 102..299 CDD:304462 61/198 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.