DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and B3gnt7

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001012134.1 Gene:B3gnt7 / 316583 RGDID:1310580 Length:397 Species:Rattus norvegicus


Alignment Length:261 Identity:74/261 - (28%)
Similarity:125/261 - (47%) Gaps:20/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LLVLITSSLRHSAARMSIRQTWMHY-----GSRRDVGMAFVLGKGKNKSVKKAIDQ----EDFMY 229
            |||::.|.:.....|..|||||.|.     ..|..|...|:||....:..:....|    ||.:|
  Rat   132 LLVVVKSVITQHDRREVIRQTWGHEWESAGPDRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLY 196

  Fly   230 QDLIRGHFIDSYNNLTLKTISLLEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTIY- 293
            .|:::..|:||:.|||||.|..|:|.|::||...::.|.|||:|:|...||..:|..:....:: 
  Rat   197 GDILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFIFKGDDDVFVNPTNLLEFLSDRQPQENLFV 261

  Fly   294 GRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQSLNTAFLKLEDVFT 358
            |...::.:|||.:.:||:|....|.|.|:|.:..|..:|::|.:...|:..........::||| 
  Rat   262 GDVLKHARPIRKKDNKYYIPAVMYSKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDVF- 325

  Fly   359 TGIVAESLNI--------RRVNVREMANTRTKFETCHIRDKITIHMVRNNEQFTLWNMLLDDTIK 415
            .|:..|.|.:        :...:..:..:|...|.|..|..:.:|.:...|...:|: |:...:.
  Rat   326 LGMCLEVLGVKPTGHEGFKTFGISRVRGSRMNKEPCFYRSMLVVHKLLPAELLAMWD-LVHSNLT 389

  Fly   416 C 416
            |
  Rat   390 C 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 61/205 (30%)
B3gnt7NP_001012134.1 Galactosyl_T 144..338 CDD:304462 61/194 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9010
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.