DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8673 and CG3038

DIOPT Version :9

Sequence 1:NP_609182.1 Gene:CG8673 / 34105 FlyBaseID:FBgn0031986 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_569833.1 Gene:CG3038 / 30970 FlyBaseID:FBgn0040373 Length:388 Species:Drosophila melanogaster


Alignment Length:241 Identity:59/241 - (24%)
Similarity:115/241 - (47%) Gaps:15/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 ICPQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRDVGM--AFVLGKGKNKSVKKAIDQ-- 224
            :|.:.......::::||...|.|.|.:.||. :......::|:  .|:|....::....:.||  
  Fly    77 VCRKAKRELLAVLIVTSYAGHDALRSAHRQA-IPQSKLEEMGLRRVFLLAALPSREHFISQDQLA 140

  Fly   225 -EDFMYQDLIRGHFIDSYNNLTLKTISLLEWADLHCPK-AKYVLKTDDDMFINVPKLLTLISTLK 287
             |...:.||::|:||:.|.||:.|.:..|:|....|.| ||:::|.|||:..:|..|...:.||:
  Fly   141 SEQNRFGDLLQGNFIEDYRNLSYKHVMGLKWVSEECKKQAKFIIKLDDDIIYDVFHLRRYLETLE 205

  Fly   288 --------ANRTIYGRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALYVQ 344
                    ::..:.|...:...|||.|.:|:::|..:|.:..:|.:.:|..|:........:..:
  Fly   206 VREPGLATSSTLLSGYVLDAKPPIRLRANKWYVSKKEYPQALYPAYLSGWLYVTNVPTAERIVAE 270

  Fly   345 SLNTAFLKLEDVFTTGIVAESLNIRRVNVREMANTRTKFETCHIRD 390
            :...:|..::|.:.||:|...|.|......:..:...:|..|.:||
  Fly   271 AERMSFFWIDDTWLTGVVRTRLGIPLERHNDWFSANAEFIDCCVRD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8673NP_609182.1 Galactosyl_T 186..374 CDD:304462 51/201 (25%)
CG3038NP_569833.1 Galactosyl_T 103..297 CDD:304462 49/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6401
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
76.870

Return to query results.
Submit another query.